Lineage for d1yk4a_ (1yk4 A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966025Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1966026Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1966035Protein Rubredoxin [57804] (8 species)
  7. 1966086Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries)
  8. 1966087Domain d1yk4a_: 1yk4 A: [162231]
    automated match to d1bq8a_
    complexed with fe

Details for d1yk4a_

PDB Entry: 1yk4 (more details), 0.69 Å

PDB Description: ultra-high resolution structure of pyrococcus abyssi rubredoxin w4l/r5s
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1yk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk4a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]}
aklsckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie

SCOPe Domain Coordinates for d1yk4a_:

Click to download the PDB-style file with coordinates for d1yk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1yk4a_: