Lineage for d1yjxd_ (1yjx D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1174790Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1174791Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1174792Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1174844Protein automated matches [190196] (7 species)
    not a true protein
  7. 1174864Species Human (Homo sapiens) [TaxId:9606] [186938] (10 PDB entries)
  8. 1174885Domain d1yjxd_: 1yjx D: [162222]
    automated match to d1e58a_
    complexed with cit, cl

Details for d1yjxd_

PDB Entry: 1yjx (more details), 2.8 Å

PDB Description: Crystal structure of human B type phosphoglycerate mutase
PDB Compounds: (D:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d1yjxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjxd_ c.60.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrk
ameav

SCOPe Domain Coordinates for d1yjxd_:

Click to download the PDB-style file with coordinates for d1yjxd_.
(The format of our PDB-style files is described here.)

Timeline for d1yjxd_: