Lineage for d1yh3b_ (1yh3 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117411Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2117455Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2117456Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2117481Species Human (Homo sapiens) [TaxId:9606] [159490] (42 PDB entries)
    Uniprot P28907 45-291
  8. 2117525Domain d1yh3b_: 1yh3 B: [162200]
    automated match to d2ef1a1

Details for d1yh3b_

PDB Entry: 1yh3 (more details), 1.91 Å

PDB Description: crystal structure of human cd38 extracellular domain
PDB Compounds: (B:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d1yh3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yh3b_ c.23.14.3 (B:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefa
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvknpedssc

SCOPe Domain Coordinates for d1yh3b_:

Click to download the PDB-style file with coordinates for d1yh3b_.
(The format of our PDB-style files is described here.)

Timeline for d1yh3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yh3a_