Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein) circularly permuted version of the "winged helix" fold |
Protein Methionine aminopeptidase, insert domain [46888] (2 species) |
Species Pyrococcus furiosus [TaxId:2261] [46889] (5 PDB entries) |
Domain d1xgnb1: 1xgn B:195-271 [16219] Other proteins in same PDB: d1xgna2, d1xgnb2 complexed with co |
PDB Entry: 1xgn (more details), 2.9 Å
SCOPe Domain Sequences for d1xgnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgnb1 a.4.5.25 (B:195-271) Methionine aminopeptidase, insert domain {Pyrococcus furiosus [TaxId: 2261]} gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk tlekagaiygypvlkei
Timeline for d1xgnb1: