Class a: All alpha proteins [46456] (218 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) contains a small beta-sheet (wing) |
Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein) circularly permuted version of the "winged helix" fold |
Protein Methionine aminopeptidase, insert domain [46888] (2 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [46889] (4 PDB entries) |
Domain d1xgna1: 1xgn A:195-271 [16218] Other proteins in same PDB: d1xgna2, d1xgnb2 |
PDB Entry: 1xgn (more details), 2.9 Å
SCOP Domain Sequences for d1xgna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgna1 a.4.5.25 (A:195-271) Methionine aminopeptidase, insert domain {Archaeon Pyrococcus furiosus} gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk tlekagaiygypvlkei
Timeline for d1xgna1: