SCOPe 2.01: Domain d1yc7a_: 1yc7 A:

Lineage for d1yc7a_ (1yc7 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (16 PDB entries)

8. Domain d1yc7a_: 1yc7 A: [162178]
   automated match to d1op9a_
   complexed with so4

Details for d1yc7a_

PDB Entry: 1yc7, 1.6 Å

PDB Description: cAbAn33 VHH fragment against VSG

PDB Compounds: (A:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yc7a_:

Sequence; same for both SEQRES and ATOM records:

>d1yc7a_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwyrqapgkerewvssisspgtiyyqd
svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs

Timeline for d1yc7a_:

• d1yc7a_ is new in SCOPe 2.01-stable
  
• d1yc7a_ appears in SCOPe 2.02
  
• d1yc7a_ appears in the current release, SCOPe 2.08, called d1yc7a1