Lineage for d1y54a_ (1y54 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950047Species Enterobacter cloacae [TaxId:550] [187307] (3 PDB entries)
  8. 1950049Domain d1y54a_: 1y54 A: [162153]
    automated match to d1gcea_
    complexed with fdt

Details for d1y54a_

PDB Entry: 1y54 (more details), 2.1 Å

PDB Description: crystal structure of the native class c beta-lactamase from enterobacter cloacae 908r complexed with brl42715
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1y54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y54a_ e.3.1.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
vsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfel
gsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqvp
devtdnaslvrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkpl
kldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmapen
vadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvvevn
ppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilealq

SCOPe Domain Coordinates for d1y54a_:

Click to download the PDB-style file with coordinates for d1y54a_.
(The format of our PDB-style files is described here.)

Timeline for d1y54a_: