SCOPe 2.08: Domain d1xxsb_: 1xxs B:

Lineage for d1xxsb_ (1xxs B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries)

8. Domain d1xxsb_: 1xxs B: [162123]
   automated match to d1clpa_
   complexed with so4, ste

Details for d1xxsb_

PDB Entry: 1xxs, 1.8 Å

PDB Description: Structural insights for fatty acid binding in a Lys49 phospholipase A2: crystal structure of myotoxin II from Bothrops moojeni complexed with stearic acid

PDB Compounds: (B:) Phospholipase A2 homolog 2

SCOPe Domain Sequences for d1xxsb_:

Sequence; same for both SEQRES and ATOM records:

>d1xxsb_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpackkad
pc

Timeline for d1xxsb_:

• d1xxsb_ first appeared in SCOPe 2.01
  
• d1xxsb_ appears in SCOPe 2.07