Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (12 species) not a true protein |
Species Biomphalaria glabrata [TaxId:6526] [188120] (1 PDB entry) |
Domain d1xiub_: 1xiu B: [162080] automated match to d1lbda_ complexed with rea |
PDB Entry: 1xiu (more details), 2.5 Å
SCOPe Domain Sequences for d1xiub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xiub_ a.123.1.1 (B:) automated matches {Biomphalaria glabrata [TaxId: 6526]} nndmpveqileaelavdpkidtyidaqkdpvtnicqaadkqlftlvewakriphftelpl edqvillragwnelliagfshrsimakdgillatglhvhrssahqagvgtifdrvltelv akmrdmkmdktelgclravvlfnpdakgltavqeveqlrekvyasleeytksrypeepgr faklllrlpalrsiglkclehlfffkligdqpidtflmemlenp
Timeline for d1xiub_: