![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins) Pfam PF00685 similar to the nucleotide/nucleoside kinases but transfer sulphate group |
![]() | Protein automated matches [190189] (4 species) not a true protein |
![]() | Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [188114] (3 PDB entries) |
![]() | Domain d1x8kb_: 1x8k B: [162047] automated match to d1fmja_ complexed with a3p, anr, ca, emc |
PDB Entry: 1x8k (more details), 2.75 Å
SCOPe Domain Sequences for d1x8kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x8kb_ c.37.1.5 (B:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} dlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptd vfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilp npenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylar dprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlf lfyedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyreigila dgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm
Timeline for d1x8kb_: