Lineage for d1x8jb_ (1x8j B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987542Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 987619Protein automated matches [190189] (4 species)
    not a true protein
  7. 987620Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [188114] (3 PDB entries)
  8. 987624Domain d1x8jb_: 1x8j B: [162045]
    automated match to d1fmja_
    complexed with a3p, ae2, ca

Details for d1x8jb_

PDB Entry: 1x8j (more details), 2.35 Å

PDB Description: crystal structure of retinol dehydratase in complex with androsterone and inactive cofactor pap
PDB Compounds: (B:) retinol dehydratase

SCOPe Domain Sequences for d1x8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8jb_ c.37.1.5 (B:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
fyedylkdlpgsiariadflgkklseeqiqrlsehlnfekfknngavnmedyreigilad
gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm

SCOPe Domain Coordinates for d1x8jb_:

Click to download the PDB-style file with coordinates for d1x8jb_.
(The format of our PDB-style files is described here.)

Timeline for d1x8jb_: