SCOPe 2.08: Domain d1x7ta1: 1x7t A:10-125

Lineage for d1x7ta1 (1x7t A:10-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d1x7ta1: 1x7t A:10-125 [162042]
   Other proteins in same PDB: d1x7ta2
   automated match to d1eta1_

Details for d1x7ta1

PDB Entry: 1x7t, 1.6 Å

PDB Description: structure of ttr r104h: a non-amyloidogenic variant with protective clinical effects

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1x7ta1:

Sequence, based on SEQRES records:

>d1x7ta1 b.3.4.1 (A:10-125) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprhytiaallspysysttavvtnp

Sequence, based on observed residues (ATOM records):

>d1x7ta1 b.3.4.1 (A:10-125) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalispfhehaevvftandsgprhytiaallspysysttavvtnp

Timeline for d1x7ta1:

• d1x7ta1 first appeared in SCOPe 2.01, called d1x7ta_
  
• d1x7ta1 was called d1x7ta_ in SCOPe 2.07