Lineage for d1x1ea_ (1x1e A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581655Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
  8. 1581663Domain d1x1ea_: 1x1e A: [162028]
    automated match to d1vl8a_

Details for d1x1ea_

PDB Entry: 1x1e (more details), 1.76 Å

PDB Description: Crystal Structure of TT0495 protein from Thermus thermophilus HB8
PDB Compounds: (A:) 2-deoxy-D-gluconate 3-dehydrogenase

SCOPe Domain Sequences for d1x1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ea_ c.2.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkgl
vkralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeag
wgrvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvete
ftlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay

SCOPe Domain Coordinates for d1x1ea_:

Click to download the PDB-style file with coordinates for d1x1ea_.
(The format of our PDB-style files is described here.)

Timeline for d1x1ea_: