Lineage for d1wrvb_ (1wrv B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953348Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1953349Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1953446Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1953447Protein automated matches [190815] (10 species)
    not a true protein
  7. 1953507Species Thermus thermophilus [TaxId:274] [188090] (1 PDB entry)
  8. 1953509Domain d1wrvb_: 1wrv B: [161978]
    automated match to d1a3ga_
    complexed with cl, mpd, plp

Details for d1wrvb_

PDB Entry: 1wrv (more details), 1.5 Å

PDB Description: Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase
PDB Compounds: (B:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d1wrvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrvb_ e.17.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade
allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat
rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw
ltyvn

SCOPe Domain Coordinates for d1wrvb_:

Click to download the PDB-style file with coordinates for d1wrvb_.
(The format of our PDB-style files is described here.)

Timeline for d1wrvb_: