Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.0: automated matches [191499] (1 protein) not a true family |
Protein automated matches [190815] (10 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [188090] (1 PDB entry) |
Domain d1wrvb_: 1wrv B: [161978] automated match to d1a3ga_ complexed with cl, mpd, plp |
PDB Entry: 1wrv (more details), 1.5 Å
SCOPe Domain Sequences for d1wrvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wrvb_ e.17.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 274]} qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw ltyvn
Timeline for d1wrvb_: