Lineage for d1wrva_ (1wrv A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248742Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2248743Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2248862Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2248863Protein automated matches [190815] (13 species)
    not a true protein
  7. 2248939Species Thermus thermophilus [TaxId:274] [188090] (1 PDB entry)
  8. 2248940Domain d1wrva_: 1wrv A: [161977]
    automated match to d1a3ga_
    complexed with cl, mpd, plp

Details for d1wrva_

PDB Entry: 1wrv (more details), 1.5 Å

PDB Description: Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase
PDB Compounds: (A:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d1wrva_:

Sequence, based on SEQRES records: (download)

>d1wrva_ e.17.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade
allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat
rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw
ltyvn

Sequence, based on observed residues (ATOM records): (download)

>d1wrva_ e.17.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
aawewvrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeeg
yvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymad
evfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn

SCOPe Domain Coordinates for d1wrva_:

Click to download the PDB-style file with coordinates for d1wrva_.
(The format of our PDB-style files is described here.)

Timeline for d1wrva_: