Lineage for d1wgzc_ (1wgz C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206326Species Thermus thermophilus HB8 [TaxId:300852] [188073] (2 PDB entries)
  8. 2206329Domain d1wgzc_: 1wgz C: [161954]
    automated match to d1k9xa_
    complexed with gol, zn

Details for d1wgzc_

PDB Entry: 1wgz (more details), 2.6 Å

PDB Description: crystal structure of carboxypeptidase 1 from thermus thermophilus
PDB Compounds: (C:) carboxypeptidase 1

SCOPe Domain Sequences for d1wgzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgzc_ d.92.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
rvlvervtgeapsarpflaylekkyaalyg

SCOPe Domain Coordinates for d1wgzc_:

Click to download the PDB-style file with coordinates for d1wgzc_.
(The format of our PDB-style files is described here.)

Timeline for d1wgzc_: