Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (17 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [188073] (2 PDB entries) |
Domain d1wgzb_: 1wgz B: [161953] automated match to d1k9xa_ complexed with gol, zn |
PDB Entry: 1wgz (more details), 2.6 Å
SCOPe Domain Sequences for d1wgzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgzb_ d.92.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp rvlvervtgeapsarpflaylekkyaalyg
Timeline for d1wgzb_: