Lineage for d1wcua_ (1wcu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1778038Species Piromyces equi [TaxId:99929] [188072] (1 PDB entry)
  8. 1778039Domain d1wcua_: 1wcu A: [161947]
    automated match to d1oh3a_
    complexed with gol

Details for d1wcua_

PDB Entry: 1wcu (more details), 1.5 Å

PDB Description: cbm29_1, a family 29 carbohydrate binding module from piromyces equi
PDB Compounds: (A:) non-catalytic protein 1

SCOPe Domain Sequences for d1wcua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcua_ b.18.1.0 (A:) automated matches {Piromyces equi [TaxId: 99929]}
vsatysvvyetgkklnsgfdnwgwdskmsfkdnslvltadpdeygaislknlnsnyygkg
gciylqvkteteglvkvqgvrgydeteafnvgsfrsssdfteykfevddeyqfdriivqd
gpasnipiymryiiystgscddhilehhh

SCOPe Domain Coordinates for d1wcua_:

Click to download the PDB-style file with coordinates for d1wcua_.
(The format of our PDB-style files is described here.)

Timeline for d1wcua_: