Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Piromyces equi [TaxId:99929] [188072] (1 PDB entry) |
Domain d1wcua_: 1wcu A: [161947] automated match to d1oh3a_ complexed with gol |
PDB Entry: 1wcu (more details), 1.5 Å
SCOPe Domain Sequences for d1wcua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcua_ b.18.1.0 (A:) automated matches {Piromyces equi [TaxId: 99929]} vsatysvvyetgkklnsgfdnwgwdskmsfkdnslvltadpdeygaislknlnsnyygkg gciylqvkteteglvkvqgvrgydeteafnvgsfrsssdfteykfevddeyqfdriivqd gpasnipiymryiiystgscddhilehhh
Timeline for d1wcua_: