Lineage for d1w7sa_ (1w7s A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940415Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries)
  8. 2940475Domain d1w7sa_: 1w7s A: [161907]
    automated match to d1hcjc_

Details for d1w7sa_

PDB Entry: 1w7s (more details), 1.85 Å

PDB Description: wild-type aequorea victoria green fluorescent protein
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1w7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7sa_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d1w7sa_:

Click to download the PDB-style file with coordinates for d1w7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1w7sa_: