Lineage for d1w21c_ (1w21 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1553918Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1553919Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1553932Protein Influenza neuraminidase [50943] (2 species)
  7. 1553933Species Influenza A virus, different strains [TaxId:11320] [50944] (61 PDB entries)
    Uniprot P03472 84-470
  8. 1553970Domain d1w21c_: 1w21 C: [161886]
    automated match to d5nn9a_
    complexed with bma, ca, gol, man, nag, sia

Details for d1w21c_

PDB Entry: 1w21 (more details), 2.08 Å

PDB Description: structure of neuraminidase from english duck subtype n6 complexed with 30 mm sialic acid (nana, neu5ac), crystal soaked for 43 hours at 291 k.
PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d1w21c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w21c_ b.68.1.1 (C:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d1w21c_:

Click to download the PDB-style file with coordinates for d1w21c_.
(The format of our PDB-style files is described here.)

Timeline for d1w21c_: