Class g: Small proteins [56992] (100 folds) |
Fold g.32: GLA-domain [57629] (1 superfamily) Calcium ion-bound |
Superfamily g.32.1: GLA-domain [57630] (2 families) gamma-carboxy-glutamic acid-rich domain |
Family g.32.1.0: automated matches [191493] (1 protein) not a true family |
Protein automated matches [190799] (2 species) not a true protein |
Species Argyrosomus regius [TaxId:172269] [188062] (1 PDB entry) |
Domain d1vzmb_: 1vzm B: [161874] automated match to d1q3ma_ complexed with mg |
PDB Entry: 1vzm (more details), 1.4 Å
SCOPe Domain Sequences for d1vzmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzmb_ g.32.1.0 (B:) automated matches {Argyrosomus regius [TaxId: 172269]} eltlaqteslrevcetnmacdemadaqgivaayqafygpipf
Timeline for d1vzmb_: