SCOPe 2.02: Domain d1vrnm_: 1vrn M:

Lineage for d1vrnm_ (1vrn M:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [187141] (5 PDB entries)

8. Domain d1vrnm_: 1vrn M: [161869]
   Other proteins in same PDB: d1vrnc_
   automated match to d1dxrm_
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq7

Details for d1vrnm_

PDB Entry: 1vrn, 2.2 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1vrnm_:

Sequence; same for both SEQRES and ATOM records:

>d1vrnm_ f.26.1.1 (M:) automated matches {Blastochloris viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d1vrnm_:

• d1vrnm_ first appeared in SCOPe 2.01
  
• d1vrnm_ appears in SCOPe 2.03
  
• d1vrnm_ appears in the current release, SCOPe 2.08