Lineage for d1vrnm_ (1vrn M:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579961Protein automated matches [190224] (10 species)
    not a true protein
  7. 2579962Species Blastochloris viridis [TaxId:1079] [187141] (8 PDB entries)
  8. 2579970Domain d1vrnm_: 1vrn M: [161869]
    Other proteins in same PDB: d1vrnc_, d1vrnh1, d1vrnh2
    automated match to d1dxrm_
    complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq7

Details for d1vrnm_

PDB Entry: 1vrn (more details), 2.2 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1vrnm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrnm_ f.26.1.1 (M:) automated matches {Blastochloris viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOPe Domain Coordinates for d1vrnm_:

Click to download the PDB-style file with coordinates for d1vrnm_.
(The format of our PDB-style files is described here.)

Timeline for d1vrnm_: