SCOPe 2.05: Domain d1vrnc_: 1vrn C:

Lineage for d1vrnc_ (1vrn C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (18 PDB entries)

8. Domain d1vrnc_: 1vrn C: [161867]
   Other proteins in same PDB: d1vrnh1, d1vrnh2, d1vrnl_, d1vrnm_
   automated match to d1dxrc_
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq7

Details for d1vrnc_

PDB Entry: 1vrn, 2.2 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d1vrnc_:

Sequence; same for both SEQRES and ATOM records:

>d1vrnc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d1vrnc_:

• d1vrnc_ first appeared in SCOPe 2.01
  
• d1vrnc_ appears in SCOPe 2.04
  
• d1vrnc_ appears in SCOPe 2.06
  
• d1vrnc_ appears in the current release, SCOPe 2.08