Lineage for d1vrnc_ (1vrn C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925971Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 925972Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 926060Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
    consists of four heme-binding repeats
  6. 926061Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 926062Species Rhodopseudomonas viridis [TaxId:1079] [48709] (15 PDB entries)
  8. 926067Domain d1vrnc_: 1vrn C: [161867]
    Other proteins in same PDB: d1vrnl_, d1vrnm_
    automated match to d1dxrc_
    complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq7

Details for d1vrnc_

PDB Entry: 1vrn (more details), 2.2 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d1vrnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrnc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d1vrnc_:

Click to download the PDB-style file with coordinates for d1vrnc_.
(The format of our PDB-style files is described here.)

Timeline for d1vrnc_: