Lineage for d2irfh_ (2irf H:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1624Family a.4.5.23: Interferon regulatory factor [46877] (2 proteins)
  6. 1629Protein Interferon regulatory factor-2, IRF-2 [46880] (1 species)
  7. 1630Species Mouse (Mus musculus) [TaxId:10090] [46881] (3 PDB entries)
  8. 1632Domain d2irfh_: 2irf H: [16186]

Details for d2irfh_

PDB Entry: 2irf (more details), 2.2 Å

PDB Description: crystal structure of an irf-2/dna complex.

SCOP Domain Sequences for d2irfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2irfh_ a.4.5.23 (H:) Interferon regulatory factor-2, IRF-2 {Mouse (Mus musculus)}
rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp

SCOP Domain Coordinates for d2irfh_:

Click to download the PDB-style file with coordinates for d2irfh_.
(The format of our PDB-style files is described here.)

Timeline for d2irfh_: