Lineage for d1vglc_ (1vgl C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133714Family c.47.1.15: KaiB-like [102449] (3 proteins)
    Pfam PF07689; contains members with alternative folds
  6. 2133728Protein automated matches [190797] (3 species)
    not a true protein
  7. 2133741Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries)
  8. 2133745Domain d1vglc_: 1vgl C: [161859]
    automated match to d1r5pb_
    complexed with hg

Details for d1vglc_

PDB Entry: 1vgl (more details), 2.6 Å

PDB Description: crystal structure of tetrameric kaib from t.elongatus bp-1
PDB Compounds: (C:) Circadian clock protein kaiB

SCOPe Domain Sequences for d1vglc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vglc_ c.47.1.15 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkila
tpclakvlpppvrriigdlsnrekvligldllyeeigdqa

SCOPe Domain Coordinates for d1vglc_:

Click to download the PDB-style file with coordinates for d1vglc_.
(The format of our PDB-style files is described here.)

Timeline for d1vglc_: