Lineage for d1v0zd_ (1v0z D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1553918Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1553919Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1553932Protein Influenza neuraminidase [50943] (2 species)
  7. 1553933Species Influenza A virus, different strains [TaxId:11320] [50944] (61 PDB entries)
    Uniprot P03472 84-470
  8. 1553945Domain d1v0zd_: 1v0z D: [161827]
    automated match to d5nn9a_
    complexed with ca, gol, man, nag, peg

Details for d1v0zd_

PDB Entry: 1v0z (more details), 1.84 Å

PDB Description: structure of neuraminidase from english duck subtype n6
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d1v0zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0zd_ b.68.1.1 (D:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d1v0zd_:

Click to download the PDB-style file with coordinates for d1v0zd_.
(The format of our PDB-style files is described here.)

Timeline for d1v0zd_: