Lineage for d1uppj_ (1upp J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913210Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1913287Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 1913337Domain d1uppj_: 1upp J: [161821]
    Other proteins in same PDB: d1uppa1, d1uppa2, d1uppc1, d1uppc2, d1uppe1, d1uppe2, d1uppg1, d1uppg2
    automated match to d1aa1c_
    complexed with ca, cap

Details for d1uppj_

PDB Entry: 1upp (more details), 2.3 Å

PDB Description: spinach rubisco in complex with 2-carboxyarabinitol 2 bisphosphate and calcium.
PDB Compounds: (J:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1uppj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uppj_ d.73.1.1 (J:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1uppj_:

Click to download the PDB-style file with coordinates for d1uppj_.
(The format of our PDB-style files is described here.)

Timeline for d1uppj_: