Lineage for d1uppi_ (1upp I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524230Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2524231Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2524308Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2524357Domain d1uppi_: 1upp I: [161820]
    Other proteins in same PDB: d1uppa1, d1uppa2, d1uppc1, d1uppc2, d1uppe1, d1uppe2, d1uppg1, d1uppg2
    automated match to d1aa1c_
    complexed with ca, cap

Details for d1uppi_

PDB Entry: 1upp (more details), 2.3 Å

PDB Description: spinach rubisco in complex with 2-carboxyarabinitol 2 bisphosphate and calcium.
PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1uppi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uppi_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1uppi_:

Click to download the PDB-style file with coordinates for d1uppi_.
(The format of our PDB-style files is described here.)

Timeline for d1uppi_: