Lineage for d1upmp_ (1upm P:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913210Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1913287Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 1913324Domain d1upmp_: 1upm P: [161816]
    Other proteins in same PDB: d1upmb1, d1upmb2, d1upme1, d1upme2, d1upmh1, d1upmh2, d1upmk1, d1upmk2, d1upml1, d1upml2, d1upmo1, d1upmo2, d1upmr1, d1upmr2, d1upmv1, d1upmv2
    automated match to d1aa1c_
    complexed with ca, cap

Details for d1upmp_

PDB Entry: 1upm (more details), 2.3 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.
PDB Compounds: (P:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1upmp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upmp_ d.73.1.1 (P:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1upmp_:

Click to download the PDB-style file with coordinates for d1upmp_.
(The format of our PDB-style files is described here.)

Timeline for d1upmp_: