SCOPe 2.07: Domain d1fbsb1: 1fbs B:195-281

Lineage for d1fbsb1 (1fbs B:195-281)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
   automatically mapped to Pfam PF00447

6. Protein Heat-shock transcription factor [46874] (2 species)

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)

8. Domain d1fbsb1: 1fbs B:195-281 [16181]
   Other proteins in same PDB: d1fbsa2, d1fbsb2
   mutant

Details for d1fbsb1

PDB Entry: 1fbs, 2 Å

PDB Description: heat shock transcription factor dna binding domain containing the p237a mutation

PDB Compounds: (B:) heat shock factor protein

SCOPe Domain Sequences for d1fbsb1:

Sequence; same for both SEQRES and ATOM records:

>d1fbsb1 a.4.5.22 (B:195-281) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlakyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefene

Timeline for d1fbsb1:

• d1fbsb1 first appeared (with stable ids) in SCOP 1.55, called d1fbsb_
  
• d1fbsb1 appears in SCOPe 2.06
  
• d1fbsb1 appears in the current release, SCOPe 2.08