Lineage for d1u2ed_ (1u2e D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617768Species Escherichia coli [TaxId:562] [188027] (1 PDB entry)
  8. 1617772Domain d1u2ed_: 1u2e D: [161801]
    automated match to d2puha1
    complexed with cl

Details for d1u2ed_

PDB Entry: 1u2e (more details), 2.1 Å

PDB Description: Crystal Structure of the C-C bond hydrolase MhpC
PDB Compounds: (D:) 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase

SCOPe Domain Sequences for d1u2ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ed_ c.69.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
qpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnidplve
agyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghssvaf
tlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvfdtsd
ltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrndrfvp
mdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp

SCOPe Domain Coordinates for d1u2ed_:

Click to download the PDB-style file with coordinates for d1u2ed_.
(The format of our PDB-style files is described here.)

Timeline for d1u2ed_: