Lineage for d1u0qa_ (1u0q A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758317Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)
  8. 1758347Domain d1u0qa_: 1u0q A: [161796]
    automated match to d1qd0a_

Details for d1u0qa_

PDB Entry: 1u0q (more details), 1.6 Å

PDB Description: structure of a llama vhh domain raised against a carbazole molecule
PDB Compounds: (A:) immunoglobulin heavy chain variable domain

SCOPe Domain Sequences for d1u0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0qa_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlqesggglvqaggslrlscaasgrtfstyavgwfrqapgkerefvgyfgtrggrtyy
adsvkgrftiaidnakntvylqmnslklddtavyycavrmpysgdyrssgtydywgqgtq
vtvss

SCOPe Domain Coordinates for d1u0qa_:

Click to download the PDB-style file with coordinates for d1u0qa_.
(The format of our PDB-style files is described here.)

Timeline for d1u0qa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u0qb_