SCOP 1.69: Domain d1fbua_: 1fbu A:

Lineage for d1fbua_ (1fbu A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (1 protein)

6. Protein Heat-shock transcription factor [46874] (2 species)

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)

8. Domain d1fbua_: 1fbu A: [16176]

Details for d1fbua_

PDB Entry: 1fbu, 2 Å

PDB Description: heat shock transcription factor dna binding domain

SCOP Domain Sequences for d1fbua_:

Sequence; same for both SEQRES and ATOM records:

>d1fbua_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerh

Timeline for d1fbua_:

• d1fbua_ first appeared (with stable ids) in SCOP 1.55
  
• d1fbua_ appears in SCOP 1.67
  
• d1fbua_ appears in SCOP 1.71
  
• d1fbua_ appears in the current release, SCOPe 2.08, called d1fbua1