Lineage for d1t0pa_ (1t0p A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999157Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 999158Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 999159Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 999222Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 999223Species Human (Homo sapiens) [TaxId:9606] [53303] (25 PDB entries)
    Uniprot P20701 153-334
  8. 999234Domain d1t0pa_: 1t0p A: [161739]
    automated match to d1mqaa_
    complexed with mg, nag

Details for d1t0pa_

PDB Entry: 1t0p (more details), 1.66 Å

PDB Description: structural basis of icam recognition by integrin alpahlbeta2 revealed in the complex structure of binding domains of icam-3 and alphalbeta2 at 1.65 a
PDB Compounds: (A:) Integrin alpha-L

SCOPe Domain Sequences for d1t0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0pa_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
vkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvcildtfeclkdlft

SCOPe Domain Coordinates for d1t0pa_:

Click to download the PDB-style file with coordinates for d1t0pa_.
(The format of our PDB-style files is described here.)

Timeline for d1t0pa_: