Lineage for d1sjza_ (1sjz A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133575Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 2133588Protein automated matches [190780] (3 species)
    not a true protein
  7. 2133592Species Escherichia coli [TaxId:562] [188019] (7 PDB entries)
  8. 2133599Domain d1sjza_: 1sjz A: [161729]
    automated match to d1i9da_
    complexed with cs, so4, tas; mutant

Details for d1sjza_

PDB Entry: 1sjz (more details), 1.8 Å

PDB Description: arsenate reductase r60k mutant +0.4m arsenite from e. coli
PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1sjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjza_ c.47.1.12 (A:) automated matches {Escherichia coli [TaxId: 562]}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallkkn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl

SCOPe Domain Coordinates for d1sjza_:

Click to download the PDB-style file with coordinates for d1sjza_.
(The format of our PDB-style files is described here.)

Timeline for d1sjza_: