SCOPe 2.01: Domain d1sjza_: 1sjz A:

Lineage for d1sjza_ (1sjz A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.12: ArsC-like [69518] (4 proteins)
   Pfam PF03960

6. Protein automated matches [190780] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188019] (7 PDB entries)

8. Domain d1sjza_: 1sjz A: [161729]
   automated match to d1i9da_
   complexed with cs, so4, tas; mutant

Details for d1sjza_

PDB Entry: 1sjz, 1.8 Å

PDB Description: arsenate reductase r60k mutant +0.4m arsenite from e. coli

PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1sjza_:

Sequence; same for both SEQRES and ATOM records:

>d1sjza_ c.47.1.12 (A:) automated matches {Escherichia coli [TaxId: 562]}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallkkn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl

Timeline for d1sjza_:

• d1sjza_ is new in SCOPe 2.01-stable
  
• d1sjza_ appears in SCOPe 2.02
  
• d1sjza_ appears in the current release, SCOPe 2.08