SCOPe 2.05: Domain d1shma_: 1shm A:

Lineage for d1shma_ (1shm A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)

8. Domain d1shma_: 1shm A: [161716]
   automated match to d1g9ea_

Details for d1shma_

PDB Entry: 1shm, 1.9 Å

PDB Description: Convergent solutions to VHH domain stabilization from natural and in vitro evolution

PDB Compounds: (A:) antibody rig

SCOPe Domain Sequences for d1shma_:

Sequence, based on SEQRES records:

>d1shma_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgagrigrsvfnlrreswvtwwgqgt
qvtvss

Sequence, based on observed residues (ATOM records):

>d1shma_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgatgstydmgwfrqapgkeresvaainwgsagtyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgagrireswvtwwgqgtqvtvss

Timeline for d1shma_:

• d1shma_ first appeared in SCOPe 2.01
  
• d1shma_ appears in SCOPe 2.04
  
• d1shma_ appears in SCOPe 2.06
  
• d1shma_ appears in the current release, SCOPe 2.08