SCOPe 2.05: Domain d3dbhk_: 3dbh K:

Lineage for d3dbhk_ (3dbh K:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Nedd8 [54244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54245] (15 PDB entries)
   Uniprot Q15843

8. Domain d3dbhk_: 3dbh K: [161645]
   Other proteins in same PDB: d3dbha_, d3dbhb_, d3dbhc_, d3dbhd_, d3dbhe_, d3dbhf_, d3dbhg_, d3dbhh_
   automated match to d1nddb_
   complexed with zn

Details for d3dbhk_

PDB Entry: 3dbh, 2.85 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190ala-nedd8ala72arg)

PDB Compounds: (K:) nedd8

SCOPe Domain Sequences for d3dbhk_:

Sequence; same for both SEQRES and ATOM records:

>d3dbhk_ d.15.1.1 (K:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlrlrgg

Timeline for d3dbhk_:

• d3dbhk_ first appeared in SCOPe 2.01
  
• d3dbhk_ appears in SCOPe 2.04
  
• d3dbhk_ appears in SCOPe 2.06
  
• d3dbhk_ appears in the current release, SCOPe 2.08