SCOPe 2.05: Domain d3c7vd_: 3c7v D:

Lineage for d3c7vd_ (3c7v D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families)

5. Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold
   automatically mapped to Pfam PF07467

6. Protein automated matches [190210] (1 species)
   not a true protein

7. Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries)

8. Domain d3c7vd_: 3c7v D: [161627]
   Other proteins in same PDB: d3c7va_, d3c7vc_
   automated match to d1jtgb_

Details for d3c7vd_

PDB Entry: 3c7v, 2.07 Å

PDB Description: structural insight into the kinetics and delta-cp of interactions between tem-1 beta-lactamase and blip

PDB Compounds: (D:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d3c7vd_:

Sequence; same for both SEQRES and ATOM records:

>d3c7vd_ d.98.1.1 (D:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyaayatfgfts
aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgfyrgsahlwftdgvlqgkrqwdlv

Timeline for d3c7vd_:

• d3c7vd_ first appeared in SCOPe 2.01
  
• d3c7vd_ appears in SCOPe 2.04
  
• d3c7vd_ appears in SCOPe 2.06
  
• d3c7vd_ appears in the current release, SCOPe 2.08