SCOPe 2.05: Domain d3c4ob_: 3c4o B:

Lineage for d3c4ob_ (3c4o B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families)

5. Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold
   automatically mapped to Pfam PF07467

6. Protein automated matches [190210] (1 species)
   not a true protein

7. Species Streptomyces clavuligerus [TaxId:1901] [188443] (12 PDB entries)

8. Domain d3c4ob_: 3c4o B: [161622]
   Other proteins in same PDB: d3c4oa_
   automated match to d1jtgb_
   complexed with so4

Details for d3c4ob_

PDB Entry: 3c4o, 1.7 Å

PDB Description: crystal structure of the shv-1 beta-lactamase/beta-lactamase inhibitor protein (blip) e73m/s130k/s146m complex

PDB Compounds: (B:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d3c4ob_:

Sequence; same for both SEQRES and ATOM records:

>d3c4ob_ d.98.1.1 (B:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqmkllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslkcfdvdgysstgfyrgmahlwftdgvlqgkrqwdlv

Timeline for d3c4ob_:

• d3c4ob_ first appeared in SCOPe 2.01
  
• d3c4ob_ appears in SCOPe 2.04
  
• d3c4ob_ appears in SCOPe 2.06
  
• d3c4ob_ appears in the current release, SCOPe 2.08