SCOP 1.69: Domain d1etc__: 1etc -

Lineage for d1etc__ (1etc -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (6 proteins)

6. Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)

8. Domain d1etc__: 1etc - [16162]

Details for d1etc__

PDB Entry: 1etc

PDB Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix dna binding motif

SCOP Domain Sequences for d1etc__:

Sequence; same for both SEQRES and ATOM records:

>d1etc__ a.4.5.21 (-) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad

Timeline for d1etc__:

• d1etc__ first appeared (with stable ids) in SCOP 1.55
  
• d1etc__ appears in SCOP 1.67
  
• d1etc__ does not appear in SCOP 1.71