SCOPe 2.01: Domain d3bj2c_: 3bj2 C:

Lineage for d3bj2c_ (3bj2 C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (30 species)
   not a true protein

7. Species Yellow perch (Perca flavescens) [TaxId:8167] [188574] (3 PDB entries)

8. Domain d3bj2c_: 3bj2 C: [161617]
   Other proteins in same PDB: d3bj2b_, d3bj2d_
   automated match to d1xq5a_
   complexed with ace, hem

Details for d3bj2c_

PDB Entry: 3bj2, 2 Å

PDB Description: met-Perch Hemoglobin at pH 6.3

PDB Compounds: (C:) hemoglobin alpha

SCOPe Domain Sequences for d3bj2c_:

Sequence; same for both SEQRES and ATOM records:

>d3bj2c_ a.1.1.2 (C:) automated matches {Yellow perch (Perca flavescens) [TaxId: 8167]}
slsskdkdavkalwgkiadkaeeigadalgrmlavypqtktyfshwkdlspgsapvnkhg
ktimgglvdavasiddlnagllalselhaftlrvdpanfkilshcilvqlavkfpkdftp
evhlsydkffsavaralaekyr

Timeline for d3bj2c_:

• d3bj2c_ is new in SCOPe 2.01-stable
  
• d3bj2c_ appears in SCOPe 2.02
  
• d3bj2c_ appears in the current release, SCOPe 2.08