Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (253 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d3b75c_: 3b75 C: [161605] Other proteins in same PDB: d3b75b_, d3b75d_, d3b75f_, d3b75h_, d3b75t_ automated match to d1a00a_ complexed with fru, glc, hem, oxy, po4 |
PDB Entry: 3b75 (more details), 2.3 Å
SCOPe Domain Sequences for d3b75c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b75c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d3b75c_: