SCOPe 2.02: Domain d2zpha_: 2zph A:

Lineage for d2zpha_ (2zph A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)

6. Protein automated matches [190256] (4 species)
   not a true protein

7. Species Rhodococcus erythropolis [TaxId:1833] [187042] (17 PDB entries)

8. Domain d2zpha_: 2zph A: [161600]
   Other proteins in same PDB: d2zphb_
   automated match to d2ahja_
   complexed with fe, mg, tb0, trs

Details for d2zpha_

PDB Entry: 2zph, 1.59 Å

PDB Description: Complex of Fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 340min at 293K

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2zpha_:

Sequence; same for both SEQRES and ATOM records:

>d2zpha_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
aqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpefrqll
ltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyksfeyr
arvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkd
cligvaipqvp

Timeline for d2zpha_:

• d2zpha_ first appeared in SCOPe 2.01
  
• d2zpha_ appears in SCOPe 2.03
  
• d2zpha_ appears in the current release, SCOPe 2.08