SCOPe 2.07: Domain d2z31b_: 2z31 B:

Lineage for d2z31b_ (2z31 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d2z31b_: 2z31 B: [161591]
   Other proteins in same PDB: d2z31c1, d2z31c2, d2z31c3, d2z31d1, d2z31d2
   automated match to d1u3hb1

Details for d2z31b_

PDB Entry: 2z31, 2.7 Å

PDB Description: Crystal structure of immune receptor complex

PDB Compounds: (B:) T-cell receptor beta-chain

SCOPe Domain Sequences for d2z31b_:

Sequence; same for both SEQRES and ATOM records:

>d2z31b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd
gykasrpsqenfsltlesatpsqtsvyfcasgdasggntlyfgagtrlsvl

Timeline for d2z31b_:

• d2z31b_ first appeared in SCOPe 2.01
  
• d2z31b_ appears in SCOPe 2.06
  
• d2z31b_ appears in the current release, SCOPe 2.08