Lineage for d2z31b_ (2z31 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105805Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)
  8. 1105846Domain d2z31b_: 2z31 B: [161591]
    Other proteins in same PDB: d2z31c1, d2z31c2, d2z31d1, d2z31d2
    automated match to d1u3hb1

Details for d2z31b_

PDB Entry: 2z31 (more details), 2.7 Å

PDB Description: Crystal structure of immune receptor complex
PDB Compounds: (B:) T-cell receptor beta-chain

SCOPe Domain Sequences for d2z31b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z31b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd
gykasrpsqenfsltlesatpsqtsvyfcasgdasggntlyfgagtrlsvl

SCOPe Domain Coordinates for d2z31b_:

Click to download the PDB-style file with coordinates for d2z31b_.
(The format of our PDB-style files is described here.)

Timeline for d2z31b_: