SCOPe 2.01: Domain d2z31a_: 2z31 A:

Lineage for d2z31a_ (2z31 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)

8. Domain d2z31a_: 2z31 A: [161590]
   Other proteins in same PDB: d2z31c1, d2z31c2, d2z31d1, d2z31d2
   automated match to d1ac6a_

Details for d2z31a_

PDB Entry: 2z31, 2.7 Å

PDB Description: Crystal structure of immune receptor complex

PDB Compounds: (A:) T-cell receptor alpha-chain

SCOPe Domain Sequences for d2z31a_:

Sequence; same for both SEQRES and ATOM records:

>d2z31a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqtggqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsenygnekitfgagtklqvvp

Timeline for d2z31a_:

• d2z31a_ is new in SCOPe 2.01-stable
  
• d2z31a_ appears in SCOPe 2.02
  
• d2z31a_ appears in the current release, SCOPe 2.08