| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (7 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
| Domain d2ve6h_: 2ve6 H: [161575] Other proteins in same PDB: d2ve6a1, d2ve6a2, d2ve6d1, d2ve6d2, d2ve6g1, d2ve6g2, d2ve6j1, d2ve6j2 automated match to d1ddhb_ |
PDB Entry: 2ve6 (more details), 2.65 Å
SCOPe Domain Sequences for d2ve6h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ve6h_ b.1.1.2 (H:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d2ve6h_: